SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G09500.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G09500.1
Domain Number 1 Region: 44-360
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.71e-106
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 359-405,435-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-31
Family Glycosyl hydrolases family 32 C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G09500.1   Gene: BRADI1G09500   Transcript: BRADI1G09500.1
Sequence length 573
Comment pep:novel chromosome:Brachy1.0:1:6808102:6810031:-1 gene:BRADI1G09500 transcript:BRADI1G09500.1
Sequence
MAIIQARTWVVFLLLALLSPSWPVAEASHHVSPDLQSLDAGLAADALRTGYHFQPPMHWI
NDPNGVMYYKGVYHLFYQYNPKAAVWGNIVWAHAVSTDLVNWVMLEPAIYPTAPFDVNGC
WSGSATVLPDGRPAIMYTGIDGDGRQVQNVAYPKDLSDPYLREWVKPDYNPVIPPGSGVN
ATAFRDPTTAWLGPDGLWRLVVGTKDNHRGLAVLYRSRDFQSWAPAEGGPLHHGDTGMWE
CPDFYPVGDGAQTKHVLKVSLDLTRFEYYTFGSYDHANDTYVPDAALADGERGLRYDYGN
FYASKTFLDTANKPRRVLWGWANESDSTADDVRKGWAGVQAIPRKLWLAPDGKQLMQWPV
AEVESLRGNHVNITDRLVEAGSYFEVQGLMIPAQADVEVSFAVVGGLDKAEPFDPAWRGA
DAQTVCAARGADAEGGVGPFGLWVLASDQLKERTAVFFRVFNDDGKHVVLMCNDPSRSSY
ADHLYKPTFAGFIDVDLAKTGGKIPLRTLIDHSMVESFGGHGKMSILSRVYPTQAVGDKA
RLYVFNNGETDVKVTHLNAYDMRSAKISTEIDR
Download sequence
Identical sequences I1GNL1
15368.BRADI1G09500.1 EG:BRADI1G09500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]