SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G68420.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G68420.1
Domain Number 1 Region: 99-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000681
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G68420.1   Gene: BRADI1G68420   Transcript: BRADI1G68420.1
Sequence length 285
Comment pep:novel chromosome:Brachy1.0:1:66931384:66932466:-1 gene:BRADI1G68420 transcript:BRADI1G68420.1
Sequence
MELVFCIVICLSFAFLLPSFATATAPTGMIQRETKQQILASIPPHWQENPVLFLTSPSGK
YGAYFIRSQTAPGAGGLGADFCYVEVLDTTEPGAEGRSVWESECLAVSTVNTCALVFSWK
GLEVFDGSNSVWHTHDTESDDNNFLETLQLVDEGDMRVLDKGGELAWKASDEPRAAQHCG
LPGSPGLASAMPPFAEPAGQGSGNLPFGQEQGGNGNGLPQAAGYGGASSGQGQAVEGVGE
TIGFGSQPLVDSSPYDSGALKQGCTFLGIGVALGLTAVASMILGI
Download sequence
Identical sequences I1H7J5
XP_003561830.1.954 15368.BRADI1G68420.1 EG:BRADI1G68420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]