SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G02720.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G02720.1
Domain Number 1 Region: 171-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.5e-29
Family B3 DNA binding domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 53-109
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000085
Family GCC-box binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G02720.1   Gene: BRADI2G02720   Transcript: BRADI2G02720.1
Sequence length 364
Comment pep:novel chromosome:Brachy1.0:2:1921269:1922752:1 gene:BRADI2G02720 transcript:BRADI2G02720.1
Sequence
MGVETEILSSTATQYSSAASTATTESGAGRIPTAALPAVTSRPPTSSSSSSSSRFKGVVP
QPNGRWGAQIYERHSRVWLGTFPDESSAARAYDVAALRYRGRDAATNHPSTAGAAASVSG
AELAFLAAHSKAEIVDMLRKHTYADELRQGLRRGQGAGARVRTPAWARQVLFEKAVTPSD
VGKLNRLVVPKQHAEKHFPLKRRASSQLPEPEKTAGAGIGAGNKGVLLNFEDGEGKVWRF
RYSYWNSSQSYVLTKGWSRFVREKGLGAGDAIVFSCSSAYGEKQFFIDCKKKNGKLVSMP
TACASATKGGEEEAGRVVRLFGVNIGAGEKRAAPAEQGGLFKRQCVQADRRQQQSPALGA
FVCL
Download sequence
Identical sequences I1HBV4
XP_003565321.1.954 EG:BRADI2G02720.1 15368.BRADI2G02720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]