SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G50890.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G50890.1
Domain Number 1 Region: 347-428,507-577
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.59e-17
Family Canonical RBD 0.0067
Further Details:      
 
Domain Number 2 Region: 838-913
Classification Level Classification E-value
Superfamily SPOC domain-like 0.00000745
Family SPOC domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G50890.1   Gene: BRADI2G50890   Transcript: BRADI2G50890.1
Sequence length 944
Comment pep:novel chromosome:Brachy1.0:2:50599135:50607117:1 gene:BRADI2G50890 transcript:BRADI2G50890.1
Sequence
MYKWNLAIVTRGGDVDVVAYRTCRACSIGLVDICSTASSEAPKSAVITGICSAVYMSVLT
FFISTFDGKDIYHIGSRRLSKLQDPVELLDILKEESGGHNQPAHDCLFELRALSLLCIFL
LFPKNLLEACFVLIASAEVDHVKRGLYCLNQLTCHLNNGTSNDSLDNNADVASQCIDMEI
DMDIDMSDTEEIADSKPSDVSGVSGSSMAESNECYITMAISRHPSLRGWIVRRYKKLCDS
CRSDVLSEVSSCLKVLGSLSELDEDKSHMDCELSVPEKLDESAGEKTDNIDSYEGKSVQM
VHSDDLKTEKLADAKTAGCKGGTAVQVARPDLYVASVSSDVISVSKELWVGSLGNNAAEA
LVRSKFEEFGPLTNFLFHPSKDFALVEYGNIMHAVQAVGYMQGSSIWGGGLQIRYLDRLI
GSKGFIGGIAVGESCHIYVAKVKNQNEKDDVFGELKSAGLKRPCGFIDISSENALLLEFE
TAVDAAVAKAHIRRQADSNVSSQDNDTSAYQLFVQNMDKSIPDSEFINAFSRFGEICRWK
FNRLDGNCLIDYKLHSAACSAKSHMHGARFGLKSISVESRACSSISVHDKTLSPVIPMSA
QSASDSSSCHETRNPRVSGYHAGYTVQGDRPIYGPPPPNAKQLWHYKELESNRTPQGILP
IPPVSTHRASVIPPPPPIQTSFVRPVYPGPGSPWENTTPIPPFSRVSPRMMPGNNFRINP
PAPLPFIPSSITPLTQLPGGSAQHPEKMPPPLDIPPPPRSPPPLPISRPPSAPPPPDSPP
VHPATDPSNSQKPYSHPQWQGSITKSGLHYCTIYASRIELDVCRYENAVSEPAEWPSRLD
VTKRTRIQHVKTIFSNTPPSKREVCRLLPCSNGDQKGFRDFISYLKQKEYAGVIKIPPVK
PRLSRLLFILPPTSDVFGMLGLPPHPAECLIALILLKEATSEVS
Download sequence
Identical sequences I1HRY9
15368.BRADI2G50890.3 EG:BRADI2G50890.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]