SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G02037.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G02037.1
Domain Number 1 Region: 31-154
Classification Level Classification E-value
Superfamily At5g01610-like 1.29e-23
Family At5g01610-like 0.0029
Further Details:      
 
Domain Number 2 Region: 325-388
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000103
Family F-box domain 0.0052
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G02037.1
Domain Number - Region: 160-191
Classification Level Classification E-value
Superfamily F-box domain 0.00275
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G02037.1   Gene: BRADI3G02037   Transcript: BRADI3G02037.1
Sequence length 429
Comment pep:novel chromosome:Brachy1.0:3:1201857:1213820:-1 gene:BRADI3G02037 transcript:BRADI3G02037.1
Sequence
MHGQILAWKVDQKFTTSPQMNQFFLLIYTLWSVTAMAIQHLLLTVLVASILHAASSAPTA
YDVLEQNNLPRGLLPQGVQSYVLHGGDLGVTLPNVCEFSVSVAGKQYKFRYDKAVGGVIQ
SGSLTKVYGVRVQVEFAWLGFNQVQRVGDQLNLHLETSTFRCVSKEWRVLIADPAFAAEH
GSRHAAEPYVVATHLRGNYSSGIVQDLQMLDMEGNVMRTIKGAGGSGLISPSVGDLICIA
DSFKNPDASCRVVDLVTRNVAAECPKLHVEPHHRWARYNIFGFGRAVTEHDDVLLYSQSE
ILSLPWRRRRQIRPPPMTPHRSPAAAATLPNDLILDILSRLPVWSVCRFRCVCNEWRALI
SDPAFAAEHRSRHAAGFVRPNSGGTVHDLQLMDMDGHVRRTTKGAGGHASRKASPGRCLL
HINNKPGQG
Download sequence
Identical sequences I1HWK0
EG:BRADI3G02037.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]