SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G20210.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G20210.1
Domain Number 1 Region: 390-472
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000323
Family UBX domain 0.046
Further Details:      
 
Domain Number 2 Region: 96-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000373
Family Glutathione peroxidase-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G20210.1   Gene: BRADI4G20210   Transcript: BRADI4G20210.1
Sequence length 622
Comment pep:novel chromosome:Brachy1.0:4:23298256:23307073:1 gene:BRADI4G20210 transcript:BRADI4G20210.1
Sequence
MEQGSVSSIRFVPGYVFGSSFLFATPSPVQEAACSLPAPQPLRLSFTGIGIRTVLFFYLS
ASGLAISSCFASNILLHSALLTCWYYEPISTENTMKSLTYKGSIPDAINQSRREKKLFVV
YLSGEDETSRGLECSTLVDEHVAQVIGRYCIFLHLKQGNVDALQFSAIYPQKSIPSVSVI
GLNGVMLWNHEGYIRPEDLKENIEKAWAALHVQETEATLLTASRMAEPVNTDSTSLPAQD
GSSTSENHSNSSSKSIGCSAVSEFDNSTDFVAVAQTPNSTGHAVLLKINEQESSESDSAP
GDISVEEKLDSACKAALPDCSGSSNVDSCKNPIQRDSTLSPKRKNKVNGSGTAAPSEPIP
SITNDRSISSKSPVEQDKATSSTPTELTTNSAKKDDIQLVIRMSNGPSLQIKLTKGDVLR
KVKNFVDENQGSGVGSYNLAMLYPRTLFTEQDMEKTLYELGIETRQALLVVPNHQSVKVP
RHQLSSPSRGFDRHKDSDNSGSSGYWGILGSALSYINPLSYLRGDPTSSNPEQLGNEGSQ
QYRRSSSPLNHPGTEAASEPRPLASNRSQETASHSSGNSLRRRPRQFGANIHTLSSEEQG
PSDDRNVFWNGNSTEFGSDDKK
Download sequence
Identical sequences I1IM01
15368.BRADI4G20210.1 EG:BRADI4G20210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]