SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G23067.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G23067.1
Domain Number 1 Region: 223-472
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-55
Family Protein kinases, catalytic subunit 0.00063
Further Details:      
 
Domain Number 2 Region: 116-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-24
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G23067.1   Gene: BRADI5G23067   Transcript: BRADI5G23067.1
Sequence length 497
Comment pep:novel chromosome:Brachy1.0:5:25180971:25183924:-1 gene:BRADI5G23067 transcript:BRADI5G23067.1
Sequence
MKVPDKFLHLWNRSFHECATDRVQQQLLVYGICLCQLEQLRRYGRPVEMLDTSRGRNGLM
ATHCISFFFLLFLSSSCKSDDQLTYAKPLTHDDILISKGGDFALGFFSPTSSNKSFYLGI
WYHSIPGPLTVVWVANRDKPISSPSSAMLAITNGSRMVLFDSEGHDIWTTTSNTVTGGFE
ASAVLLNSGNFVLRLSNSTEIWQSFDHPTDTILPNMRILGTLEGGNEVAVKRLSKGSGQG
TLEFRNEVVLIAKLQHKNLLRFTLIMQDVARKYELDWLTRFKIIKGIARGLLYLHQDSRL
TIIHRDLKASNILLDKEMIPKISDFGMARIFGANQNQANTIHVVGTYGYMSPEYVTGGAF
STKSDTYSFGVLLLEIVSGLKISSPQLIPNFSSLITYAWRLWEDGKATELVDSSVVDSCK
IHEVLRCIHVGLLCVQDRPDDRPLMSSVMFALENESAVLPAPKQPVYFSLCNYEDGEARE
SMENSANAMSITKLEGR
Download sequence
Identical sequences I1J296
EG:BRADI5G23067.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]