SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Vocar20003420m|PACid:23136696 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20003420m|PACid:23136696
Domain Number 1 Region: 191-409
Classification Level Classification E-value
Superfamily Kelch motif 1.18e-40
Family Kelch motif 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20003420m|PACid:23136696
Sequence length 449
Sequence
MATYYNGAEQPQFNSLDGTVQGAQYAAKPTNRSSSSVLQALSKACAIFYFLLLTAVAVIA
FILGGYATARVRSIHISDAVLVSDPKTAPAGYSVFSLGTGLGYWSPAADMIHARSDHGVI
SYQKYAYLIGGLTAFNGSNATVLRSVVQYDTETGLMYEMKPLPEARYRFAYAQLNGQIYV
MGGSSDVEKGTPTNTVFVYNISGNSWSPIGQLQTPRVDPCGAAANGKVYVFGGYDLDGNS
LSTVEVCDPSTAAGSAPAVCTQLPARSNLLDARGDCRAVSIDNIIYAMGGAQWFNNTKQN
CTANWVYCYKFLNTVEAFNPATGQWSPRAPMISKRGDFGIEALPGGRIIVAGGERGNGTQ
NFMAMYDVEEYIVQDDIWVQKAPLPEARFRDDLAYVSGRVYAFGGTPTCDLIEGAPCSKL
ALKTVFAYFDVVYPRLYAFFKPANTNANS
Download sequence
Identical sequences D8UEW5
Vocar20003419m|PACid:23136695 Vocar20003420m|PACid:23136696 jgi|Volca1|107594|estExt_fgenesh4_pg.C_700066 XP_002957257.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]