SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|538395967|ref|YP_008517540.1| from Variovorax paradoxus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538395967|ref|YP_008517540.1|
Domain Number 1 Region: 72-203
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.68e-25
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-16
Family GntR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538395967|ref|YP_008517540.1|
Sequence length 255
Comment transcriptional regulator, GntR family [Variovorax paradoxus B4]
Sequence
MSTSASEISARIVEAVMAQKLAPGSRLGEQPLAMLFDCSRTIVREALTRLAARGIVTVSA
RRGWFVIEPSQDEAREAFEARRVIELGLIRSTGKIDKAALRQLKAHLQREKAALKESDVG
NRSFLLGDFHVCLAECLGNTLLADTLRDFTARTTLIAMLYQSTHDAVQSCEDHVQIVAAL
ERGDHAAAEALMAAHIGTVQSALRVQAPTDPLAQLRDALAPLQQKKTTAARPGRRKAASP
SPDDTDSSTYLGALL
Download sequence
Identical sequences T1XD48
gi|538395967|ref|YP_008517540.1| WP_021008324.1.102015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]