SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g00590 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g00590
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000587
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy01g00590
Sequence length 164
Comment chrom=[bathy_chrom_01] coords=[;103487..103981;] status=[complete sequence]
Sequence
MKPAWDKLGSKYKDHASVMIVDVDCTADGAQTCQKMGVQGYPTIKYFLAGDKKGKDYQQG
RDFDAMLAFTKKTLDVEKCDVKTKKACKPNEIALIEKFDGKTSADIAEELKKRSEELKTI
KSDMKAAKLEHNTKVATWKKREAALNKGEAILKQLEQLRKKDEL
Download sequence
Identical sequences K8EP82
Bathy01g00590 XP_007515376.1.44737 MES00004638958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]