SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g03030 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g03030
Domain Number 1 Region: 155-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-30
Family Thioltransferase 0.00088
Further Details:      
 
Weak hits

Sequence:  Bathy01g03030
Domain Number - Region: 45-157
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0183
Family ETX/MTX2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy01g03030
Sequence length 257
Comment chrom=[bathy_chrom_01] coords=[;575167..575940;] status=[complete sequence]
Sequence
MSHTRRDTTASKERRGTEKERRNFDNILSCLPPLFAVFVALLSEFSSNISVSPKVLFFSK
YNTHTHTHTRTHAHTHTHTHTHTHTHTHTHTHKRKAAEMMMATTTFTSSLSSPSIRSSSG
AKTSISSSFNSTTTTSKKSSTTFSRRIRANLGPELKTQIDKCVTENKVVLFMKGTKSAPK
CGFSNTCVQILQSMNVPFTDVDILASEQLRVGMKTYSSWPTFPQLYIGGEFFGGCDITMD
AYKDGSLKEELERAMLE
Download sequence
Identical sequences K8EAC0
XP_007515765.1.44737 Bathy01g03030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]