SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g04000 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g04000
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily EF-hand 3.81e-43
Family Calmodulin-like 0.00000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy01g04000
Sequence length 113
Comment chrom=[bathy_chrom_01] coords=[;742632..742973;] status=[complete sequence]
Sequence
MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELHEAFKVFDKD
GNGTISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGEVNYEEFVKMMMAK
Download sequence
Identical sequences K8E936
Bathy01g04000 XP_007515313.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]