SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g04560 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g04560
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.34e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 93-240
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000195
Family Glutathione S-transferase (GST), C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy01g04560
Sequence length 242
Comment chrom=[bathy_chrom_01] coords=[;845253..845981;] status=[complete sequence]
Sequence
MTTSSLPKLKLTYFNIQGPAEKVRLALTIGKVPFEDHRIAMPGQSDEWKEQYKPKTPFGK
VPVLEIDGKEVVSQSDALLRYAGILANENGVELYPQGGMAQLRTDEMISLVDEMANSWAP
RLYVGMQPKNFGYPDDDAWKGSDEHKKATEIARTRWVDDDLPVYLGHVKKQLAKSGGKFL
CGEKVTIADCYLVPMLNRLSSGGIDYVDKECVAKHGGAEVTDYVERFMNIEEVKKWYAPK
DV
Download sequence
Identical sequences K8EQK8
XP_007515826.1.44737 Bathy01g04560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]