SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g06200 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g06200
Domain Number 1 Region: 168-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.43e-19
Family PDI-like 0.0048
Further Details:      
 
Weak hits

Sequence:  Bathy01g06200
Domain Number - Region: 421-473
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00157
Family Heme-dependent catalases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy01g06200
Sequence length 528
Comment chrom=[bathy_chrom_01] coords=[;1125642..1127228;] status=[complete sequence]
Sequence
MGILTKAKGMDFYRKIPRDMTQGTYLGTILSILATSLIVFLLIAETRAYLKTTFETKVVV
DRSVDGELLRINFNVSFPALSCEFASVDVGDALGLTRYNLTKTVFKRPIDGNFRPTGPLA
WAEKTPGKDGDAHVNEEELTEAQIVVEKHKEALATGRVTHSSAEPLTTEEEMQAFNDAHS
VTMINFYAPWCPWSQRLQPVFDAAAIQLHETFNTNSQNMHSIALGRVNCVEHEQLCRKHH
IQGYPTVRIFTRGSDLIAHGRHTDHASYHGDRTVSAIVEFGKSMVDVPAGGEGNIPVPKG
KPTKDNEKKPQPPRPNEQIDFKVANHADVVQTRASTGCSITGFVLVKKVPGHVFFTADAK
NGHSFDVDKLNVTHQVHHFYFGQQLSASRQKYMARFHRGEKEGDWHDKLANDFVVSKNPR
TSHEHYLQTVLTTMQPLGPFAQPFNVYEYTQHTHSVKTPDGETPRAKFHFTPSPVQILGV
EKRREFYQFITTLMAIVGGVYSVVGIIDGLMHNTSLMFKRKMQLGKAM
Download sequence
Identical sequences K8EQA2
XP_007515721.1.44737 Bathy01g06200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]