SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g06230 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g06230
Domain Number 1 Region: 173-297
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 93-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000608
Family Glutathione S-transferase (GST), N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy01g06230
Sequence length 334
Comment chrom=[bathy_chrom_01] coords=[;1131652..1132656;] status=[complete sequence]
Sequence
MMMQTIHTQRYQSGNSATSSSSSKKSTKQQPSSSSFRLCGSGGAAALRKSGFNGGEKMNK
RRRGRCALMSAAESSSEETTGDFEAALDPVYKNIFYDVPVSNNGARNRLIICWKNIEDEF
EFKNPSTLGGLKSPEFLEMHPQGKMPLLVTKDGQAIPESEVISQYLCDAFEKQGPSLRPE
TLEAKTACNLATRWHDVYLTPIQGCMYRGPMSPEVRAEQISEIDRLLDVMEKTVGGFEPG
PYLCGDKPSTADAALFPTFVFMTHLLPKYFGWENVFDGRPSLERWYKHMSTEDACAKKIK
MEVMGGLMAWDESDRYEKNGLVAAVANDSFQWSY
Download sequence
Identical sequences K8E995
Bathy01g06230 XP_007515300.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]