SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy02g00940 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy02g00940
Domain Number 1 Region: 81-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-30
Family Thioltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy02g00940
Sequence length 192
Comment chrom=[bathy_chrom_02] coords=[;168570..169148;] status=[complete sequence]
Sequence
MSSHQRLLSSTSRRALSRYASTSYFSSAGSSHSFSSVGAAQHHLVFKNNNINNINNKKHV
FSTTTGSHDDFAAKSHVDASNAHEEIASDVAKETVVIYMKGSPNAPQCGFSNVACRILDH
YGIPYASRNVLASDALRNGIKSFSNWPTIPQVFVGGEFLGGSDILMTMHQDGSLKKEFER
VGLTVKTTEGSD
Download sequence
Identical sequences K8EB60
XP_007514821.1.44737 Bathy02g00940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]