SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy02g02830 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy02g02830
Domain Number 1 Region: 27-290
Classification Level Classification E-value
Superfamily SIS domain 4.23e-41
Family mono-SIS domain 0.021
Further Details:      
 
Domain Number 2 Region: 264-362
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000177
Family CBS-domain pair 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy02g02830
Sequence length 365
Comment chrom=[bathy_chrom_02] coords=[;529690..530787;] status=[complete sequence]
Sequence
MSNILTGCCGGARAGHELKAAAQISKQSIQSLFTEQSAFLDQFFQTLDFEETAKFCQKVL
DCKGTTLFTGIGKSSYIAKKVCQTLVSTGTRAIHLAPVDALHGDIGNVNEGDIVVLFSKS
GTTEELVNLVPYAKAKGGFLVAATANKESQLAKLCDMHVTIPAPGELQPFEKGSSSVGTS
ESRVSPPVTYTALQMMFGDTCAVYIMQARGLTQDEYAMNHPAGRIGKRLVLRVQDVMRKI
ESLPTVSPEEKGLEVLVKMAGDTKGCGCLLVVDKDMTLLGTFSDGDLRRATVAKGAEVSN
LLVKDLMNYNKAFPRCCEAEQMAYEAQMSMNLNGKMVDYLPVISGDGKKTLFGLITIESL
SEAGM
Download sequence
Identical sequences K8EAY6
XP_007514827.1.44737 Bathy02g02830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]