SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g03360 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g03360
Domain Number 1 Region: 76-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.05e-27
Family PDI-like 0.0032
Further Details:      
 
Domain Number 2 Region: 418-551
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.87e-26
Family PDI-like 0.0088
Further Details:      
 
Domain Number 3 Region: 194-287
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000252
Family PDI-like 0.012
Further Details:      
 
Domain Number 4 Region: 283-372,408-445
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000668
Family PDI-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy03g03360
Sequence length 571
Comment chrom=[bathy_chrom_03] coords=[;640528..642243;] status=[complete sequence]
Sequence
MRSSFSLLTLFLFATTTFFTTTFCVLLVNVAAPIGFSNAATIRDENADDTNENKGQRKRG
INVNEDPNVYQYKRGTEEHVEVLTNENFKKFTTSGEHVLVTFYAPWDGHSKSFLKQFHEL
GTSHTISSDSRLKFGKVDATVEKELAKEYEVETYPQIILFRHGQPKEYKGSLAANGEGLR
KWLRRNTHHKPAAWLEGVDDVHVFTLGRPVCIVGFFDDTGHLDNFHAAAYDFHLDFGETS
SKIATEKYKTQRPGIIMFRNFAEPAHFQGNVNSLEEIKQFIATNMVPKVVDYAKKDQMER
VFEGPIAANVFLFRQQNDEEADKLEAEFAKAADQLYGRVHFISAGFDEQTLYSFFAIRAR
DTPTVRLYAHDLKYAYKGSLKPDEGKKEVMKTIKDHDGNDIPNPKYDEEMASQTSKVFED
LIKFVDAYEKGKLVPILKSEKPPKSAPSANEATVVVGRTFDEIVTQSNKHVMLFFYAPWC
QTSKALMPLWDKLAEMYREYDEVTIAKMDATKNEAKGIHVKSYPTIYFYKSGDKPRHEEF
DEKKKDLASFIRFIGERTKLDPTRPPIHDEF
Download sequence
Identical sequences K8ECS1
XP_007514332.1.44737 Bathy03g03360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]