SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g03720 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g03720
Domain Number 1 Region: 13-160
Classification Level Classification E-value
Superfamily EF-hand 2.33e-48
Family Calmodulin-like 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy03g03720
Sequence length 164
Comment chrom=[bathy_chrom_03] coords=[;709331..709816,709929..709937;] status=[complete sequence]
Sequence
MSFAKKGTTSSSSSTGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVSMRALGFEPKKEE
IAKMMHEVDKDGSGTITFEDFLKLMTAKMGERDGKEEILKAFRLFDDDDTGKISFKNLKR
VAKELGETMTDEELQEMIEEADRDGDGEVNEEEFFRIMKKTALF
Download sequence
Identical sequences K8EC69
XP_007514094.1.44737 Bathy03g03720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]