SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g04190 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bathy03g04190
Domain Number - Region: 133-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0725
Family Glutathione S-transferase (GST), N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy03g04190
Sequence length 312
Comment chrom=[bathy_chrom_03] coords=[;792807..793745;] status=[complete sequence]
Sequence
MTTTRAAAAALFCANTRNRSSKSGVKSFLFFGGKKRSSFCGKHHHSRFRYLSKSSYSSLG
TEEGWMRGKRRKDNNNDENNNSSSSLDAIVVVAGGFTPDNLWLPEWVLERLDYCAEAHKK
ANEKAYICIAGSATPHKPPPLQKGGFIYHESTMMAEYLIDTHDVHPGKILKDTSSMDTIG
NAYFTRYVHAIPRGWKNVEVVTSKFHMRRVKAAFEWVWGMPLEGNGDEDTQIRFVSTRDS
GLSKETLIAREEREIESEKQLRENAKMYDTPDKFAEWMFTTHKCYAVTRQHEIGDFEAVK
KELGSNAEKLGY
Download sequence
Identical sequences K8ET73
Bathy03g04190 XP_007514208.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]