SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g04790 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g04790
Domain Number 1 Region: 411-780
Classification Level Classification E-value
Superfamily SIS domain 8.91e-96
Family double-SIS domain 0.000000442
Further Details:      
 
Domain Number 2 Region: 2-46,102-256,319-363
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.69e-47
Family Class II glutamine amidotransferases 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy03g04790
Sequence length 780
Comment chrom=[bathy_chrom_03] coords=[;900848..903190;] status=[complete sequence]
Sequence
MCGIFAYLNCGVPKTKKEIVEKLLVGLKRLEYRGYDSAGFAMDDNEKWCEDDDDDDDDEE
EGGDKKRHDAKKVIVCREVGKIANLEALARKELFGEDDDDENEVKASKSKSSNGRKKSSS
SIKPLDFCASIAHTRWATHGPPNKINTHPHTSDSRENEFVVVHNGIITNHAPLRAMLERR
GMKFETDTDTEVIPKLCKFLSDKFEESGEKDVTFRQLAMEVTRQLQGAYALVFKSTKYPG
ELVAAKRGSPLLMGISDDSGEVSCVIDGNLSDGAEEDVLLKKASGNKKRKSMTGGAAAAA
AADADTTTTTRITTTTTTTTNNPKVEFYFASDASAMVEHTKRVLVLEDDDVCHCHDGTYK
IYKVEKQKHPHPGYTSGHDSPEYGLYKPVVLSKEVERTIETLEMEVESIMKGEFDHFMQK
EIFEQPEAISSTMRGRLVLDVLGAAERVMLGGMSQFAATIRRSRRIILCGCGTSYNSAIA
IRQLFEELTELPVTLELASDVLDRRCPFFRDDTCIFISQSGETADTLKALEYAKAKGALC
VGIVNTVGSAISRATDCGVHINAGAEIGVASTKAYTCQIVAMVLVALSLSEDSRSKHTRR
DDIMQGLLKLPGCVKECLKMDAILLELAQELKEEHSLLIFGRGFNYATALEGALKVKEVA
LVHSEGILAGEMKHGPLALVDKHMPIIVVCTNDGSYEKQQSVVQQLKARDGRLILIVSDD
DTEMEKTAPDAVILRVPKVEDCLQAVVNIVPLQLLSYHLTVLRGHNCDQPRNLAKSVTVE
Download sequence
Identical sequences K8EC35
XP_007514100.1.44737 Bathy03g04790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]