SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g05320 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g05320
Domain Number 1 Region: 62-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.76e-16
Family PDI-like 0.016
Further Details:      
 
Domain Number 2 Region: 505-582
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000339
Family Thioltransferase 0.069
Further Details:      
 
Weak hits

Sequence:  Bathy03g05320
Domain Number - Region: 639-762
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00364
Family PDI-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy03g05320
Sequence length 861
Comment chrom=[bathy_chrom_03] coords=[;1015725..1018310;] status=[complete sequence]
Sequence
MAMNNSRRFSLRLSFVLLLFAMMMMMMMLMPPNYENESAFLMKRKQSQGTTTGGFMFASA
AKTDDDDDDDDYDEEEEEEESAKENNVFHMEVRTLYDPNNSGVFGFQSSEEFKEKVLETR
DVWVVQFIAPGCQPCKDMAPAFSRAALSLESVNIKFGAIDIAGNEDLGRSMQISRVPAIV
GFGGKKTWNPYRKIAQKLSNEYRGDALTARALREFAVKNLPDDEVARIDSVDELKNVVSD
EMPTLVYVTDKSETPFMLKSLAWNHKNRIRVVELTYDSSTDDLLPTPVLPGLEAHEDEED
AVKLVLYKDADLTKKPTLFDGESMSKDEVFAFAEKHLGPEVGELEVEVLRKKKDDGEDKS
GDEKKKGEEEEENNDDFSLFIEKKPKNFEQDVIEKKEAVVVMFTKRTDECGLKVNEAIDA
FAKLQFQAELYEYVVNRDGEDILKAIKLAETQTLSKFPNKDECFSLMYYPFGENKEDEES
YPFEVSEDHPVNDGNLKAWMYENTADVVLRITQDNLDQYLATDPFTPKCVLFSQKDETPG
MYKTLAANFKDDFHFGFFQADDKNDPNLQKFNIPKLPAVQLLFVNPAVTPQQEASGNVQM
NSAPFPGPMNYIYLRQWLLEAKNQIKRKDEAKSPGKVTPPPHVTTQKEFEDECESKGGLC
AIAFIPGTSSSSQSMFEDRMERAFEAAKLTSGRPFTWIVVDPIVQKTFAKAFDVLPHNSP
TVTVLQPRKGRYATMSGSFDPRELARHCELVLNGKTRTFMIQDVPKIIDGGESEDENDYE
PEEPIEEEFDLNDIMGEETEDATLGLTRAEIAELERKKEEEELAEAARVKEEEEKKQQQQ
KSSGKKKKKKGKKGKKKKEDL
Download sequence
Identical sequences K8ETT3
Bathy03g05320 XP_007514428.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]