SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g05430 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g05430
Domain Number 1 Region: 250-377
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.4e-18
Family PDI-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy03g05430
Sequence length 674
Comment chrom=[bathy_chrom_03] coords=[;1036461..1037608,1037665..1038541;] status=[complete sequence]
Sequence
MNASLTGKGGKGGGNGGISGSGGLISRRTTSNGGANSLPGESPSNETFVTQTLKTVDVFK
RNDALEEFSKEGSNKGGVLTLLFAWFIFGLVTSQVQKLFATSMRTDLSVDHDMDPTLVMQ
FDVSFPAINCEHLSVDLVDAVGHRAFNLSGESIYKHSMSKEIPYLAIEHATMGVGSRQHF
HAIAPRSLHPYWEGDEGKPLGRIVQGDEFDYIVGDDDNEYGGEVNDEEEANDKSSLEQRR
DEYGYRRFALLLNSENFKRNVNAHGVLLVNFHAPWCSHCAALAPHFERGAQLVQKALAKS
LNSRLSAAFAGVDCTAEENKKLCDDEKILAYPTIRVYRGSSSDAILLNKSKGDIRHFEVY
HGPRTSEAMAEFTLSLLRTMRENDTRTINDAPSTSSSFSSSDGGGGEEEKPPRNVRAHRL
GYDFDRDGRHESTVRSSGCTVEGRIRLAKVPGAVYFSARSYGQTIDLHRINSTHIINHFS
FGEYVPTTSTKRSYVPKKFRKAWSLAAKDGGGKFATEKGFAKGENIFSSQHRNTIHEHHM
QVVTRSIVPLNAATLTLNEYTFSSNKFKISPSSAQQESSSYFDGVHGEDNDFSNGATHAI
SKRGAYVKFTFAISPIAISHVETEQNIFEWLISSVTVLGGVVAFTFALESMLHSSVRKAA
RMYRKRMLAASKCT
Download sequence
Identical sequences K8ETX3
XP_007514458.1.44737 Bathy03g05430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]