SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g05460 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g05460
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.15e-16
Family Thioltransferase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy03g05460
Sequence length 153
Comment chrom=[bathy_chrom_03] coords=[;1042748..1043209;] status=[complete sequence]
Sequence
MRGDGEEEIAFSVSDLSSSLSSSSLSSSSSSTTTTTQRNVSVIKGEESFKKKLDETKGKQ
LVVVNFGASWCKHCHKLSPSVFDEAEKYPNSEFIFTDVDLLPETAKFMRWTPTVGIYKFG
RKVDEIEQCKIRQLKDRVWLWSDLKETRFESRG
Download sequence
Identical sequences K8ESQ1
Bathy03g05460 XP_007513993.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]