SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy04g02470 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy04g02470
Domain Number 1 Region: 636-762
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-19
Family Thioltransferase 0.01
Further Details:      
 
Domain Number 2 Region: 577-646
Classification Level Classification E-value
Superfamily EF-hand 0.000000000133
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy04g02470
Sequence length 785
Comment chrom=[bathy_chrom_04] coords=[;472951..473218,473464..475553;] status=[complete sequence]
Sequence
MSLSSLSFVHPKNVNVGFQNPIREKSRSNVMKKQRRRRRLRAKTPQTRAMAAVQDEEATK
PQPEPANWEYKYLYDGACPVCRSLKAGLEGTGKGKGKIYYVNIADPLYDASKHQGVTFEE
AMDTLHVLKRDGGEPLQGLPAIETLFGVVGFGWAVKLATLPPVGFVASLMYKLISSNRLK
LGGDSAVGAGIMALGRVGLELRGEKASCAEGDECRGMADLEVEEGQRGVEVSPSTSSDGD
GSTVEGGAVSLPGNSVDFSDVFSSGPEFVLGAYASGGYITAAIVSVRSGELDSELIEEEV
TDVLDINNVGVALKSLCKRLKWQGGVAVALPGVWHAEQQDNATVQQYDMMESLSPTESRA
EREETEESFRNLVGLDVAVITGAEAHGYGHADLWGDVNKVNDSSNEKVNEMDGLVGVVTA
GQEAMHVALFKDGTLLTNADFRSADLASTWNNEEWSACPPPSKDCEDEEQWSKWATRVAV
HLARVEACRCARGGLKRWVVAGSAGENFDKWSHLVPELSVTLAQKQAAPLVKGGANRTEG
VRGAAAGGGFRFRYAADVLRVRAAIGKELGKSPQLVDTEQLRTLFDRFSDPASSETVDRD
SFIRMVSALGIRLPPDEIRELIVDVDMDDSNQISFEEFEGWYRQVVGTGAVTVLHTEQAV
DQVLSEEKGTGRCVVLKVGFTSCAPCKKFLPHFEQRALDFRENARFVRIYGNENASTIHL
ARDRLAVKTTPTFFVFKDGELTHSHSGANVEKFDDAVKEQMGELDEGTYKQNWEKPAVDE
VVPSI
Download sequence
Identical sequences K8EUD5
XP_007513545.1.44737 Bathy04g02470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]