SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy04g04910 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy04g04910
Domain Number 1 Region: 77-264
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.57e-36
Family PAPS reductase-like 0.0061
Further Details:      
 
Domain Number 2 Region: 509-631
Classification Level Classification E-value
Superfamily EF-hand 4.61e-23
Family Calmodulin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 349-442
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000197
Family PDI-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy04g04910
Sequence length 693
Comment chrom=[bathy_chrom_04] coords=[;993820..994570,994834..996164;] status=[complete sequence]
Sequence
MNTVMSCAAHVSTTTASSSSSKMMKMMKKSGAVSGVKRRVVNQNMKKKNNNNRRGNALKV
FSSNTKQETESKNEILEKTMTPLEIMDDALKTYGDDIAIAFSGAEDVALIQYAHLTNRPY
RVFSLDTGRLNPETYELFDQVEKHFNIKIEYCVPNEEKLEAFVNEKGLFSFYEDGHKECC
GIRKVQPLRKKLSTLKAWITGQRKDQSPGTRMQVPAIQLDPAFQGILNGSELVKYNPLTN
ATSQEVWDFLRVMSTPVNALHTQGYVSIGCAPCTRPVTPGQQEREGRWWWENASDKECGL
HSGNLSKEEKEKQDKREEDAADIFTDASAISVETRESMEKRISRGLKNEENEMIVLYAPW
CPFCQAMEGSFTESAQTYGKAKNVRYSKFRADQDEKEWSKENLSLASFPTILLFPKGREG
YVKLGGERRDVESLQIFVESIVGKELSFLFFCATTRVSFFYPILLTVVLSLVVVWCPSKS
NDTRREQTTHISLLFSSSYEQTEISSYCYNVFTSAEIQTLYKRFQQLDKKHKGYISEDEL
LNIPELAINPLAPRIVQLFVNVNFKEFCRLLSLLSKNANEKSKISFMFRVYDVDADGIVS
RNDLEIILRQLVGSTLSEEKIDALVQKAMNEVLELENNTSNSDSNNRKNNSSSSNNNNNA
TALPGLTESAFYSVFSSGNAELVPTVSIHEDDD
Download sequence
Identical sequences K8ED65
Bathy04g04910 XP_007513487.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]