SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy05g05060 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy05g05060
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily EF-hand 1.96e-28
Family Penta-EF-hand proteins 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy05g05060
Sequence length 145
Comment chrom=[bathy_chrom_05] coords=[;989076..989081,989128..989559;] status=[complete sequence]
Sequence
MGGSDEYLLRENFKMIDADNSGIISPTELQRALGSHGLLFSLQTISLLIKLHSTRGTGTL
DFSEYVSLNNFLEKTQSEFAKFDVNKDGKLGKAEVFRALSSMGFGECDSRAIEEACKSFD
PSRENKIGVPEFIALVLFLTSAKKT
Download sequence
Identical sequences K8EWV9
XP_007513367.1.44737 Bathy05g05060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]