SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy06g02310 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy06g02310
Domain Number 1 Region: 68-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.96e-25
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy06g02310
Sequence length 212
Comment chrom=[bathy_chrom_06] coords=[;416401..417039;] status=[complete sequence]
Sequence
MSSSNNDASNTNIIRDGLNAINNYWMSIPIPDAFRALITVLVFRNILFAIRRYFFGDERE
LARNGGDKGLVVECESLEQVEKEIEKAKRREKAVAIDYGATWCPPCRRMKPIFAKMSREF
RDACAFLAVDVDKARDASMAAKIQCMPTFQFYMKDGEKLDEEVQGLDVGKLRRILTKDLG
CRASEEEEKEEKENAKIIAQPGPGTIKDKKMN
Download sequence
Identical sequences K8EX77
Bathy06g02310 XP_007512470.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]