SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy06g03720 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy06g03720
Domain Number 1 Region: 280-402
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.31e-23
Family Thioltransferase 0.0029
Further Details:      
 
Domain Number 2 Region: 158-298
Classification Level Classification E-value
Superfamily TPR-like 2.81e-17
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 
Domain Number 3 Region: 12-103
Classification Level Classification E-value
Superfamily TPR-like 0.000000907
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy06g03720
Sequence length 413
Comment chrom=[bathy_chrom_06] coords=[;696981..698222;] status=[complete sequence]
Sequence
MLEGENEEEQKKAAEHARLKGNDFYKRRKYHDAINSYCDSINTHPTSSALSNLAIALSGA
GPTQNRLNVIRCLLLSVSLEPERVKAVEKLNTELTLSGDIEAASRMASGEMMIRMDGFTP
KRVRECFQKMEKESVFPKKCEENLKDLSASLRQVFIGKETGNGCFRAGDFEDAKNAYTAG
INAATAEYSQVMDTGMSEKKARVVTPGVSILLCNRSLMKSKLGDYQGALDDANEAIRAVL
DGDVNYVKALLRKADALKKQEKFSDAFEAYFLCWTRLPGDANIANELNECVEKSERPNKK
SFKAIAGPRACSDMNEYNALIQNHELVLVDFHAKWCGPCKQIAPAYAAMNLNKYRSVLFL
KVDVDEAQDIAAREAVQAMPTFVLYRYGMKMDVMRGADVNSLDRLVSRWTQTI
Download sequence
Identical sequences K8EGW5
Bathy06g03720 XP_007512644.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]