SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g02120 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g02120
Domain Number 1 Region: 46-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000372
Family Thioltransferase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy07g02120
Sequence length 253
Comment chrom=[bathy_chrom_07] coords=[;432402..433163;] status=[complete sequence]
Sequence
MSFSHNGISLRALTRNCEPKRQLQKRRENNVALSPLALALSRTNALVYGAPHCLKCRAAK
ALLHFLFGNSEWQSHHVDVSLAKNCLQSVGVKTVPTWEINGKRFGGIFDANRASVTTGAH
VGELVGWTVLQRKVGSEREAEKMVFDARRRNTNTNSSTSSNSDENSSNNSKKGVDVTYLG
GASLGDVARGAWKTPGRRRTRTRTRRRSGWCKRVAVRLAMRGEGKFWCEFGELRSEKSEK
RARNAHNVALEPM
Download sequence
Identical sequences K8F2N7
XP_007512214.1.44737 Bathy07g02120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]