SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g02740 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g02740
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-32
Family spliceosomal protein U5-15Kd 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy07g02740
Sequence length 142
Comment chrom=[bathy_chrom_07] coords=[;540384..540812;] status=[complete sequence]
Sequence
MSYLLPHLHTGWHVDQAILSEEDRVVILRFGRDGDETCMRQDEILSNVAEKIKNFAVAYL
VDIDEVPDFNEMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWAMDSKQEFIDIVECVF
SGARRGKGLVISPKDYSTKYRY
Download sequence
Identical sequences K8FE64
XP_007511883.1.44737 Bathy07g02740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]