SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g02800 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g02800
Domain Number 1 Region: 63-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000192
Family HyaE-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy07g02800
Sequence length 236
Comment chrom=[bathy_chrom_07] coords=[;551852..552562;] status=[complete sequence]
Sequence
MEEVTQNPMDEANPVSFAVLRIPFFLEPEYSRDETWSETNRKRLERKWGGKEAFDAQKKR
HQLKERGREVGIQHFNLDRKASNTLKSHRLVQWVTKNYGCAKSEALYDVLNVEHFVNGKK
LNDAKMLLECAKKISDGVIDLEKAEKFLASDEGEKEIVLAKKALDRLGIHSIPNFVIGGK
EVLSGAVHWKELVGAFRRIERTGLGAPENAFATILGIPEEIITQTTLDPTKYAATV
Download sequence
Identical sequences K8F1M8
XP_007511869.1.44737 Bathy07g02800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]