SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g03470 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g03470
Domain Number 1 Region: 189-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.73e-21
Family Thioltransferase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy07g03470
Sequence length 324
Comment chrom=[bathy_chrom_07] coords=[;677500..678474;] status=[complete sequence]
Sequence
MRKKRLKIFSQSLKNFRSKKPVGKHQQKFLRTGKNNITHNEMMMFSSSSSSSSSPRRVLL
LRPSCRGGNEKTRNENSPFRGGGKGGKGARRTPTTTTRTRRLLTSAAASSKESSSSPSEK
KTKTSKSSSDTITNINTTTNTKKKKGEKERQQKIKEYWKDRRKVACQENDPMCLDIMRTP
MKSFDEMEEEEQELNALAPEFMDGDVVLGKVNDVPSFPVFKGEILNAPEETLNVVEFTFS
WCRPCKKFAAKYDMFAEYYDKVRFFKVVGDSDPVLATTAKSMNVTSTPHFFLFRGGKMVG
SFTGTNEDNFREELGFAMKDEEKP
Download sequence
Identical sequences K8F2U5
Bathy07g03470 XP_007512249.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]