SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g04170 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g04170
Domain Number 1 Region: 89-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000338
Family Thioltransferase 0.0084
Further Details:      
 
Domain Number 2 Region: 220-279
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000000366
Family PUG domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy07g04170
Sequence length 325
Comment chrom=[bathy_chrom_07] coords=[;822598..823575;] status=[complete sequence]
Sequence
MSEETKEDEEDKEEEKKDDSEDASLACAELLRLALLSKDLSALSKATTTRLSEDGEVKQL
QRGGEEFREILMRTTKNTNNNNAGGIRCSVIVLVFSMNNCQPCVQFAPKLDRLAKEYKDL
HVGFVKCNIHESDMNRRLANEAGVFGFPCAQMYDGHTGQKVQLEGGDVKGANEAKLREGL
ETHAYNVEKFERLKRDAFEALSEAKAKIFCGEDDDEQEQEQEQQRFVTLVKTVTAYASNA
IEKEDAKYRRIKTSGKAFTERVKSVGDEGEKCLRAFGFEKKKDDDDDEEEVYEISPVVFD
EFDENNKFGKREMRRVIKMLRALTG
Download sequence
Identical sequences K8F1I5
XP_007511852.1.44737 Bathy07g04170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]