SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g04770 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g04770
Domain Number 1 Region: 212-344
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000512
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 125-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000394
Family Glutathione S-transferase (GST), N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy07g04770
Sequence length 374
Comment chrom=[bathy_chrom_07] coords=[;934596..935720;] status=[complete sequence]
Sequence
MSFAAAKHTFVQSTSSVFANRKEKKKKKNVIAFSPHQKTQKKNLIVSAEATKQAHEGIAE
AHESTLASMRMTSRNSSSSSSSSSSGTYAHEGIAEAHESSLASMRLAPARDANTATTSRP
SSKADEKDALYFSATCPFCHKIWITMLEKNISFDGFVWEDLENKSEAFCKTFATGSPDAE
ANPSVPVLRLPNGKVMVESALVMNYFCCNDTYPGVDLRPKTAEQRYDGQLFENTFNTVVP
AFFKCLRAKNEAELESAISEVEHALAKADRCLQMNASFGGDNGNYCCGNQFTSHDCATMG
FLSRLRVVLKHYRDYDLNNTLQKLPWLKSWADAVEKRPSLLKTYELVPGIVGKSSVDEAY
IAHFAKFVSWSSAI
Download sequence
Identical sequences K8FEE3
Bathy07g04770 XP_007512088.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]