SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g04790 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g04790
Domain Number 1 Region: 51-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000471
Family PDI-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy07g04790
Sequence length 191
Comment chrom=[bathy_chrom_07] coords=[;938382..938957;] status=[complete sequence]
Sequence
MTPEQLQYGVNKMQWYCEKFGGESRVMPMISRLSSVFESIGLPTYSLEGNTGPTLDGHRL
AHFMKEEYSQSHQDVFMDTIMIDYFCNSKAPCDETALLAACEKSFEANTSANAEEQKANL
ARAEEVLRDKSKYRDEVLAQVRDVQGRISGVPHFIIRNEDTKKKVEFSGAQPVETFLDAF
EELGGEGLELQ
Download sequence
Identical sequences K8FEF4
Bathy07g04790 XP_007512118.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]