SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy08g00110 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy08g00110
Domain Number 1 Region: 43-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000528
Family PDI-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy08g00110
Sequence length 195
Comment chrom=[bathy_chrom_08] coords=[;13603..14190;] status=[complete sequence]
Sequence
MNNDKNSRSKGRERMRTFYRRQRGRVPSSSSSLFAEGVSDTDDVLILYTKPGCCLCEGLE
EKLKAVLELAQQRERETTTGDVDNNSSQNNHVALDLREYALEIRDVSLKKEWADAHAGEI
PVLFVGKRGDADDAQTASKVKRPTPRVSIERLKFDLEKHLVSLTSNNTREDNASKTNEDD
TRGGGGWKVISAKPF
Download sequence
Identical sequences K8F7U9
Bathy08g00110 XP_007511562.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]