SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy08g02240 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy08g02240
Domain Number 1 Region: 17-323
Classification Level Classification E-value
Superfamily SIS domain 3.34e-52
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy08g02240
Sequence length 325
Comment chrom=[bathy_chrom_08] coords=[;404101..404153,404432..405356;] status=[complete sequence]
Sequence
MAKASPEDLKALFDTQQGYMKYFFDELDYEPLQKFCQLVLDCKGTVFFTGVGKSGFIAQK
ISMTLVSTGTKSVFLNPTDALHGDIGIVSKEDIMVMFSKSGSTTELLTLIPYARAKGATL
VGVSSNAKSKLATETDMHVMLPLERELCPFDLAPVTSTAIQMLFGDTCAVAIMQAKSLTM
DQYAMNHPAGRIGKRLILSVKDVMKPLSGLPLAKPDEKLVDALVELSSKGQGCLLVVDDA
NTLLGVFTDGDLRRSLHEKGGEVLQAPIKDLMSSTPRTTLAEGKAVDAMREMEAGGRPVS
FLPVIDEEKKLVGLLTLHGLVNAGL
Download sequence
Identical sequences K8EYK0
Bathy08g02240 XP_007511454.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]