SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy08g04370 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy08g04370
Domain Number 1 Region: 247-500
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.71e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000307
Further Details:      
 
Domain Number 2 Region: 501-705
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.22e-57
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000195
Further Details:      
 
Domain Number 3 Region: 831-991
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.29e-39
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.04
Further Details:      
 
Domain Number 4 Region: 2-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0047
Further Details:      
 
Domain Number 5 Region: 71-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000766
Family Glutathione S-transferase (GST), C-terminal domain 0.0057
Further Details:      
 
Domain Number 6 Region: 760-827
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000812
Family AlaX-M N-terminal domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy08g04370
Sequence length 1194
Comment chrom=[bathy_chrom_08] coords=[;793125..796709;] status=[complete sequence]
Sequence
MKLYGPTSRSHRIAVTAKYCSIRLDYVPVTMGETNKTEEYLKMNPFGKVPMLVCDDANET
AVFESNAICRYLCSVSGEMVYPKESGGAELRAKIDGFMDSFNQLDASGPGWLYPIIGIGK
ARGVAYDEINEERTKKTCRSFLTSLEQHLKKTMAEKRGAFLVPERGFTLADIVGASSCEN
LFLHLIPENEWNEEYPAVKFWLETVYALPEWLEAVGKMTCCQEPMRWEGEVKALKNLPID
QTENCSWSAAKVRNTFTSFFESKHAHTIVPSSPVVPHDDPTLLFANAGMNQFKPIFLGTC
DPKSPLYTLKRVTDSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAISM
AWELLTEVYKIDPDRLYATYFGGDPKQGLEPDLEARDIWLKFLPASKVLPFDCADNFWEM
GDTGPCGPCTEIHFDRIGNRDASSLVNMDDPNCLEIWNLVFIQYNREEGGVLKPLPSKHV
DTGMGFERLASCLQDRPSNYDTDVFLPIFREIQRVTGSSPYTGLLGVADAGEKDMAYRVV
ADHVRTLTVAIADGASPGSDGRNYVLRRVLRRAVRFGREKLNAKQGFFHKLVPTVVKMLG
ETFPEIKKEEKRVIEIIAEEEESFGKTLLKGIEKFKKIAEGARGENRNVISGVEAFLLWE
SFGFPNDLTEIMCEENGLTLNNEEFDQVFKAAQEKSRMSSKKNTGVDLLFQAEATAWLSN
NNIATTNDSFKYVKNVPKVDTTVKAILTSSDGFVQSTEGQSGPFGLILESTPFYAESGGQ
VSDTGSLNVNGKDLSVSEAKAAAGYILHVLSDDSVSVSVGDACTAQVDVARRSDIMPNHT
MTHVVNFALREVLGNDVNQKGSVVDDEKLRFDFSHNKPVTAKQIQEAQDIVNSQIKENLS
VHTREVALTDAQKINGLRAVFGEVYPDPVRVVSVGPAIDDLLSNPSNEAWAKRSIEFCGG
THLKSTAEAEDFAIIEEVGTAKGIRRITAATKGQARQAFQNAKDFMDTIDATAKITDLTE
LSAQLSLLKGSIDDAEKTMPFASRENLRELIVRENKRYLDEKKKAAAEAAAKAIEQLSVM
CGEASSKSENFLVANLGEGLDAKVLGECAQSVAAKGLSCALFATNDGKAVALCSVPSDVK
NKTNEAKNWLDVCLKPLGGKGGGKKGVAQGQGPNAEAMTEAMDAAAAFAKMSIK
Download sequence
Identical sequences K8F8E3
Bathy08g04370 XP_007511747.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]