SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy09g01220 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy09g01220
Domain Number 1 Region: 207-346
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.19e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 43-97,167-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000271
Family Glutathione S-transferase (GST), N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy09g01220
Sequence length 363
Comment chrom=[bathy_chrom_09] coords=[;228861..229952;] status=[complete sequence]
Sequence
MNWKTFESVRHIQMTNDGERHTAVAAVDRKGRFARNESSFRDRVSDIVSEKNRYKLIVSY
ACPWATRCLSVLYLKGLDDGIEVDIVHPTWQKTRRKRGKEDEEDTDEDDGHAGWVFPNEN
CRWIQHLSGIESAKFEVQAYHTRKDPKKTKKTEFYSIRDFYEEHDNSYKGPFTVPILYDQ
TEKRIVNNESSEIIRDLNARFQPLAKNATLDLYPESKRKEIDEMNEWTYRAINNGVYKCG
FARTQEAYEEAVEELYEGLERLESVLERSKMKFLVSDDEVTEIDVRVFQTLVRFDEVYVV
YFKTNKKCIREYKNISAYVKRLYAMPAFRKATNMWDIKTHYFTSHVALNPYGIIPKGDPS
WLT
Download sequence
Identical sequences K8F3U4
Bathy09g01220 XP_007511167.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]