SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy09g01850 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy09g01850
Domain Number 1 Region: 437-562
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000612
Family Thioltransferase 0.0049
Further Details:      
 
Domain Number 2 Region: 232-276,373-440
Classification Level Classification E-value
Superfamily EF-hand 0.00000664
Family Penta-EF-hand proteins 0.082
Further Details:      
 
Domain Number 3 Region: 52-192
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0000246
Family ROK 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy09g01850
Sequence length 574
Comment chrom=[bathy_chrom_09] coords=[;345478..347202;] status=[complete sequence]
Sequence
MASTTTSARTQLTLTTTRSMKMRMTKNFTTTRAGGLNSEKLSNNDYPIGEVVLGIELRGH
GAKGAIIDTANADFMRPGVEVDLEELKEEAVEEALSKIATHYNWGGTVGVSYTRAVMRAC
GNRDINKHIVKMFPKSKGKVGSMIHTEAAAYAQMYYGPGRDVDGVVLVVTIGRGFGTVVY
NHGQKVRNMNMTNFTWTYEGELKKLQQKFNWEGIAPGFQDDKDEEEKEKITQCIDNFGLQ
GSWEMSFDDVEKCDIGPKTREKLDEFLAWGTLVDEYLQKVTSHVQPERVILLTTGHASTL
PTKLLFKLFAPGIASAGVNPTEALLISESPSSIVKGAALGAMLELSNKATVEILRAAICK
DITGAPEPRILTDEDMQYVFKKLDRNKDSQLDAEDILRGAALYDVVLSEVEANTVLRSFA
GTSAARNQTASFDDFERWWVKTVKKSVVKHVQSQEELETYLQEKSSANENPVIVLQCGYS
YCRPCIKFEHSYESVAKDPRFKNIKFLKVVGDSSPALSHLTHELEVENTPDFRIFRGDKM
VQKFTGANRKKLEDNLIAVLESKDVNQIPGIIIK
Download sequence
Identical sequences K8F3X7
XP_007511192.1.44737 Bathy09g01850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]