SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy09g02200 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy09g02200
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.52e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.08
Further Details:      
 
Domain Number 2 Region: 238-320
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000177
Family Glutathione S-transferase (GST), N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy09g02200
Sequence length 329
Comment chrom=[bathy_chrom_09] coords=[;402473..403462;] status=[complete sequence]
Sequence
MGTNALAASSHLSSTSTRQHPRFHLRRAAKTHSSSSLYRPCRGTFHRGRIFCASDDDENN
NNNKNVLSFLCPLLKLIGGGDAAKPRNRTLEVATSGFASIARIQYGKTVLEECIQRRKQQ
PKLILYEFEACPFCRRVRETLSMLDLDCEIRPCPKDGRFRKEVLERGGKETFPYFVDETS
GKEMYESADIVNYLYEKYGNGARVPENYFTSTLITGWMPTLFRAGRGMTKYEPRKEGFVK
PQSGNIELFNYENNQFARLCREALCELELPYTLRNVGAGSPKRETLTEAGGKSVPFLIDG
DVKIGESDEIVAYLFEKYGGGYVPEKQGA
Download sequence
Identical sequences K8F3C8
XP_007511020.1.44737 Bathy09g02200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]