SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy10g00150 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g00150
Domain Number 1 Region: 214-331
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.6e-20
Family Thioltransferase 0.078
Further Details:      
 
Domain Number 2 Region: 393-491
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000568
Family UBX domain 0.0095
Further Details:      
 
Weak hits

Sequence:  Bathy10g00150
Domain Number - Region: 11-48
Classification Level Classification E-value
Superfamily UBA-like 0.00468
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy10g00150
Sequence length 513
Comment chrom=[bathy_chrom_10] coords=[;20109..21650;] status=[complete sequence]
Sequence
MVDDNDDIDAAAIQSLVEIAQLNPTQARNALKHYGNSLENACNAFFNGSLQFTENDAIKL
PADIDIVDGEEEEEEDDDLVMIDGDGTDRRTRRGNENRRSQQQEQEQTRHENATNQQQQQ
QQQLVPLLPVRAVFGLLSVAVKITSTILSKILPSNVLSSLSRAFRAHRLNQRYLAASARG
RGAVGPTRGDPIEAAKEFRRTFMNENDGNCLINFVELSHSDALRMAKSEYKLCFVYLHSP
IHDDALGFCKDVLNDPNVASFVNEKFVAWGGDVSNSDALLLALGVSPSSFPYCALLNSSG
SRVSLVVSVEGYCGSDELLEVLEKSIEDASGSMSEARSRNEAAENDRLLREEQDAAFRAS
LAADAAKEAKRVQEMEEEEARLKEAENERLENERIESENRRKEEERAMALKNRREEKAAR
LKPEPEMSVTENVTKIAFRMADGSRVERRFASRESTLNDVYDFVDTLECVSETKYSLVSN
FPRKVFHRTDELLIEVSELSSNGAMLFVQSEEQ
Download sequence
Identical sequences K8EJI6
Bathy10g00150 XP_007510819.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]