SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy10g01080 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g01080
Domain Number 1 Region: 91-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000278
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000391
Family Glutathione S-transferase (GST), N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy10g01080
Sequence length 263
Comment chrom=[bathy_chrom_10] coords=[;202459..203250;] status=[complete sequence]
Sequence
MHCTRISLSLRHSRNATVYMYRIVNLPVKIELVKLHKREHKSEPFLRVNKFGQVPALCVE
RQKGQVKFVLSESSAILKYLSEKYPSIVSESKMYSDDLREKAKIWSALDWYQTTIRSSAA
GVSWHAFVAGNMGGKVSLELAKHYEERLKMSLDVLETLRLGDTFPFLNEREHPSIADLLV
IEDIVNLVVLKGSPFREELSSLDQLLAERPRVRKWRDAVMRINKPLWDEIHGVLEMVAEN
ASKKIDSESRRRRFDDVASMSRL
Download sequence
Identical sequences K8F086
XP_007510667.1.44737 Bathy10g01080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]