SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy10g03070 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g03070
Domain Number 1 Region: 68-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000274
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy10g03070
Sequence length 604
Comment chrom=[bathy_chrom_10] coords=[;577827..579641;] status=[complete sequence]
Sequence
MKKRPRRRAKPKRLRNPFLLFLLLFLLSSFGGEFFSTAKENEGEREGEQKKLVDLLPSSI
FSRFSERVKKNPRFKLIVSVYAPWCGHCKVLEPELVSALKIVREVDGTDETVVDVVKMNG
DLRKYPIREEMEQRETEARKAFKKKYGVKGYPTLLLLEKKSDDESSRSGRSRSEEEEEEE
EELFVAKQYKGSRSQAALLNYLRRASASDVATFKDWREAREYGKLRATESNAMFFHLMVN
GGSLKIKKAFDSEAKKRENLQAWFGESDAPKTFEETNAFLDAFHAKQFPWKDIQSKDESY
SVLLAVHPRVPGDEDDDSLVSDGENYKAFTTEVVLCRVAEEKEEEEEEEKKKKKKSYRAN
DADMSETSGYENSCNVSAFVRTRIVAPLAKLDQSVFNNILDLDSPSVFLVESGGDAKIEA
FAKNAYKLALKHRKISFVRVDGDELGPWLDKEMAFGPLESSFPLCLGYHKKTHRSWYDRK
WETRGNTIEESLAVFVDMNFVDIKRLPNFLPSMPLLGKLKNIHHRATFRFSNSSSPVQRL
ATYWWLLVIALILFVLCFSFALQYQREGKFDTSSEDDSSAKSSGEAERAAKVEESDGDEP
KKTK
Download sequence
Identical sequences K8EZW2
XP_007510527.1.44737 Bathy10g03070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]