SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy10g04170 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g04170
Domain Number 1 Region: 45-236
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.47e-67
Family Glutathione peroxidase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy10g04170
Sequence length 237
Comment chrom=[bathy_chrom_10] coords=[;775589..776243,776442..776500;] status=[complete sequence]
Sequence
MNASATLSASRVIGGTSFTRKSSSSSLQKTTPRRRRGNVSVNARLVGNPAPHFEGEAVID
QEFETISLDQYKGKKYVVLFFYPLDFTFVCPTEITAFSDRYEEFSKLDCEIIGCSVDSKF
SHLAWIQTERNEGGLGDIEYPLLSDLKRQAVHAYDVYDENNGEALRGLFIIDKEGIIQHA
TINNAPFGRSVDETLRTLQAIQYVQTHTDEVCPAGWKPGDEAMKEDVKGSKEYFSKL
Download sequence
Identical sequences K8EJY4
Bathy10g04170 XP_007510798.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]