SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy10g04240 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy10g04240
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000132
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy10g04240
Sequence length 239
Comment chrom=[bathy_chrom_10] coords=[;784586..784944,785149..785509;] status=[complete sequence]
Sequence
MYLRKITQFTTSSSAKLLFTSSSTTSALLLNNNIYKTKMMSTMTTTQTNFSSRRGAIFSL
KQQQQHKKRSFSLTTRAMGAKVGDQISGVLQVGPWIDGMPTPVNMAERCKGKKVILVGLP
VPGYIAGQDKLKGAGIDEVIIFCTNDTQVMDAWGEAQGIAGTNITFMGDPNSVMVENLGV
ELTHPGPCSKLGPGRSKRFAMYIDDGVIKTFNVAESPTDPAGDDFPEVACIDNMVDTMC
Download sequence
Identical sequences K8F9X4
Bathy10g04240 XP_007510855.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]