SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g00360 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g00360
Domain Number 1 Region: 30-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.11e-24
Family Thioltransferase 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy11g00360
Sequence length 381
Comment chrom=[bathy_chrom_11] coords=[;58914..60059;] status=[complete sequence]
Sequence
MLRRAVLHSLRANTIPNLRCFASSTSTHGADVSEIQDVKELEKLIGVESERKAIIIDFYA
NWCNPCKILTPRLVKALEGKSRSIKMVKVDVDLFPNIAEALKVSSLPTVMLFHKSTLVEQ
FAGVINEDECEKFIQRAAERVLADTQDENHEDSKFLEDEEAQSTSEVVDLASIHSKVEVA
LQGLAEGSSASSATQRAALIAFTNSEASMRSAPAFLQAEIYSALAMIELNENKASLESVE
SLVNAAEQISAEAKKEGSGAPQVSFPAIAARARLKLRIRANEHNITFEDHAKCIFEYEEG
KAKSFELSLRAVLASVVVSDWERACNFSLDLLKSKSDIQGKEDLKTLGREICVEVIDSIN
FGATSALAERTRRRLASILFA
Download sequence
Identical sequences K8EKQ6
XP_007510214.1.44737 Bathy11g00360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]