SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g00550 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g00550
Domain Number 1 Region: 337-408
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000337
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy11g00550
Sequence length 434
Comment chrom=[bathy_chrom_11] coords=[;95850..97154;] status=[complete sequence]
Sequence
MNMKTRIQQHQMPSTGTRRTTTARYAVSSRRATQIRSINMTPFASISMLSSRTLHACSGR
EREREKKINARRSNQNKISSLICKAESSSPETNEAPPVNVKSKDDSTVMMSTPNKESESG
VIPRPPLKVAAALALVGSLESTYLAVQKLSGGDVVCPVGGCQTALNSSYAELFGQPLSLY
GAVAYFVVALLAFSGSSINPEESRESESKYKKSRVLFFLSTCGLAGVSSYLLYVLAVKLG
GVECIYCLTSASISYALFSIGFSGLTPKETVNASPPAVSLFFVTMLSLSLVLGFGADKAD
EGGESQFLSYKTPRIEAVSTQYSRELAKYLKESGAKMYGAFWCSHCLDQKEEFGKDTELP
YVECFPEGWQKGTEIAKVCADAKVKGFPTWVINGKTVEGDKTLEELAKESGFKTQTPFES
PSSESSSSIPDFLQ
Download sequence
Identical sequences K8EKI6
XP_007510139.1.44737 Bathy11g00550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]