SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g01230 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g01230
Domain Number 1 Region: 46-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.52e-28
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy11g01230
Sequence length 135
Comment chrom=[bathy_chrom_11] coords=[;222628..222687,222864..223211;] status=[complete sequence]
Sequence
MVKHVESADEFLALKKASKPCDPFALSPLTNASLSFQQHFEHFDLIFPDKLLVDFTATWC
GPCKAIGPYFEELAAKFPDVTFVKVDVDELDDVAASCGISAMPTFQLYSNGVMVKEMCGA
DKAKLEALANEANEL
Download sequence
Identical sequences K8EKI4
XP_007510407.1.44737 Bathy11g01230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]